kathrynleesmithwhitelineprints.com valuation and analysis
Robots.txt Information
| Robot | Path | Permission |
| GoogleBot | / | ✔ |
| BingBot | / | ✔ |
| BaiduSpider | / | ✔ |
| YandexBot | / | ✔ |
Meta Tags
| Title | Kathryn Lee Smith, white-line woodblock Provincetown print artist. |
| Description | Provincetown artist Kathryn Lee Smith has been making white-line prints (also known as Provincetown Prints) in the American single-block color woodcut tradition professionally for 35 years. Smith’s work in the historical white-line genre has pushed |
| Keywords | Kathryn Lee Smith, B.J.O. Nordfeldt, Blanche Lazzell, Oliver Chaffee, Ferol Sibley Warthen, Provincetown, Ptown Art, Ptown artists, Provincetown Artist Registry, Cape Cod, Provincetown Art, Provincetown Art Association and Museum, Provincetown Print |
Server Information
| WebSite | |
| Host IP | 206.188.192.57 |
| Location | United States |
Related Websites
| Site | Rank |
More to Explore
kathrynleesmithwhitelineprints.com Valuation
|
US$356,713
Last updated: 2023-05-13 14:43:14
kathrynleesmithwhitelineprints.com has Semrush global rank of 29,671,815. kathrynleesmithwhitelineprints.com has an estimated worth of US$ 356,713, based on its estimated Ads revenue. kathrynleesmithwhitelineprints.com receives approximately 41,160 unique visitors each day. Its web server is located in United States, with IP address 206.188.192.57. According to SiteAdvisor, kathrynleesmithwhitelineprints.com is safe to visit. |
Traffic & Worth Estimates
| Purchase/Sale Value | US$356,713 |
| Daily Ads Revenue | US$330 |
| Monthly Ads Revenue | US$9,879 |
| Yearly Ads Revenue | US$118,539 |
| Daily Unique Visitors | 2,744 |
| Note: All traffic and earnings values are estimates. | |
DNS Records
| Host | Type | TTL | Data |
| kathrynleesmithwhitelineprints.com. 7200 IN A | A | IP: 206.188.192.57 | |
| kathrynleesmithwhitelineprints.com. 7200 IN NS | NS | NS Record: ns20.worldnic.com. | |
| kathrynleesmithwhitelineprints.com. 7200 IN NS | NS | NS Record: ns19.worldnic.com. | |
| kathrynleesmithwhitelineprints.com. 7200 IN MX | MX | MX Record: 10 mx1.netsolmail.net. | |
| kathrynleesmithwhitelineprints.com. 7200 IN TXT | TXT | TXT Record: google-site-verification=dUNxXy2cN-oMmf6cYtMwYy_t18grxDvNBu-p5Js2yuo |
HtmlToTextCheckTime:2023-05-13 14:43:14
| Kathryn Lee Smith Contemporary White-Line Woodblock Prints Home Prints History Artist’s Statement Resume Contact . . . . . . . . . . . . . . To view larger image, click on thumbnail above. Kathryn Smith represents the culmination of over a century of refinement of the technique first credited to the early Provincetown printers at the turn of the 20th century. Kathi Smith’s work has evolved over the past twenty-five years from the initial simplicity of her earliest prints to a far more intense form, then back briefly to a minimalist approach and most recently to a new complexity one does not usually associate with the white-line print. Kathi Smith has crossed the fine white line with her constant desire to push this print form in the 21st century. She has found a comfort level within the block that has produced remarkable results. -- James R. Bakker, Guest Curator, Crossing the Fine White Line , New Bedford Art Museum, 2008 . . . . . . . . . . . Kathryn Smith has taken the white-line |
HTTP Headers
HTTP/1.1 200 OK Server: openresty/1.19.9.1 Date: Tue, 21 Dec 2021 14:20:22 GMT Content-Type: text/html Content-Length: 13148 Connection: keep-alive Vary: Accept-Encoding Last-Modified: Fri, 17 Mar 2017 22:03:16 GMT ETag: "335c-54af458420c56" X-Webcom-Cache-Status: BYPASS Accept-Ranges: bytes |
kathrynleesmithwhitelineprints.com Whois Information
Domain Name: KATHRYNLEESMITHWHITELINEPRINTS.COM Registry Domain ID: 1540860035_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.networksolutions.com Registrar URL: http://networksolutions.com Updated Date: 2021-01-26T18:47:30Z Creation Date: 2009-02-04T19:40:04Z Registry Expiry Date: 2022-02-04T19:40:04Z Registrar: Network Solutions, LLC Registrar IANA ID: 2 Registrar Abuse Contact Email: abuse@web.com Registrar Abuse Contact Phone: +1.8003337680 Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Name Server: NS19.WORLDNIC.COM Name Server: NS20.WORLDNIC.COM DNSSEC: unsigned >>> Last update of whois database: 2021-12-24T08:36:34Z <<< |